SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7TZG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7TZG4
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00073
Further Details:      
 
Domain Number 2 Region: 165-274
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7TZG4
Sequence length 481
Comment (tr|R7TZG4|R7TZG4_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELT99164.1, ECO:0000313|EnsemblMetazoa:CapteP142796} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_142796 OC=Capitellida; Capitellidae; Capitella.
Sequence
MIIAVGLIVLLASAHGDVPADGSLRLTGGAMETTGNVMVFYQGKWGIVCDDGWSLRAADV
VCRSLGYLRALGHTDQAYFGTPNEDVFLDNVRCRGDESSLLECDRNPWHDHDCEKSEAAG
VFCAPLPGSLSSPLRVNVSNSTPRITSPHEQHTPTQGPETNSIRMPIRLRGGRNEDEGRV
EVRVQGHWGAICGDHWTLLEATVVCKQVGKGHARSAVMSSVFGGEHLAKVLSGIDCMGEE
DSLDECSHARRSHDIACPEQDFIAGVVCTHELPDLVPNATLLESSTYLQDKQMYYLTCAM
EENCASASAYEIKKTVRDWHIHQRRLMRFSSSTWNFGTADFRPESNKADWEWHLCHMHFH
SMEVFAHYDLLDLQHNKVAEGHKASFCLEDVQCLPGKQKKFACKGYGDQGISVGCADDYL
HDIDCQWIDITDLKPGTYIFRVHINPNNHVAELSYSNNAVHCDLSYTGLSVTVTNCENGP
I
Download sequence
Identical sequences R7TZG4
jgi|Capca1|142796|e_gw1.429.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]