SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7U0L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7U0L4
Domain Number 1 Region: 62-135
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000118
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7U0L4
Sequence length 260
Comment (tr|R7U0L4|R7U0L4_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELT96735.1, ECO:0000313|EnsemblMetazoa:CapteP222489} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_222489 OC=Capitellida; Capitellidae; Capitella.
Sequence
MGSFVLRVTVFSLLCIGAKSSPTPDAHLELTISSMVYRNRERVGKISAILSNQTTSTGEL
FFCDDEVFNQSAANVICGELKYDSAYIQPSIASNGTGMQTIHSVRCAGDERQLSNCSWQV
GVRSQCRMDIVLKCSMKHSGSNRFQWVYIGIPCIVIAVIASSYRRARLYYMHRGQRGQCR
NNPPPTATNTCPVYTTENQASCTPTPYPQPPQKNPADPTDQPGMLPPTYSQTIAEDTSSL
PPPPAYGALYSAPVAPREVK
Download sequence
Identical sequences R7U0L4
jgi|Capca1|222489|estExt_fgenesh1_pg.C_5010017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]