SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7U7E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7U7E8
Domain Number 1 Region: 162-263
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0068
Further Details:      
 
Weak hits

Sequence:  R7U7E8
Domain Number - Region: 87-138
Classification Level Classification E-value
Superfamily LemA-like 0.0615
Family LemA-like 0.021
Further Details:      
 
Domain Number - Region: 41-99
Classification Level Classification E-value
Superfamily Tropomyosin 0.0628
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7U7E8
Sequence length 270
Comment (tr|R7U7E8|R7U7E8_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU01889.1, ECO:0000313|EnsemblMetazoa:CapteP220759} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_220759 OC=Capitellida; Capitellidae; Capitella.
Sequence
MRLFILILILPTVIAQEQQYCCQTAGAIVREYKRMHTRLWDEKSQTLDAQVTSVQNSLLE
IDSHVSAIEGQITAVERHMTSVEERVEERSTSLETNLEEKVAALDLKVERLIELMSANVI
ANVTQQLSLVENRITQRTSILENKMSHVDFPNLIGNSEVSLKGHSPNRGQLEVLHNGTRH
NVCPYNFTTTEAVVFCRSLGLPHENAEISDADETSNLEGLLSAIGQFISTFLQPRALRKV
NCTGASDVWFCRHSGWDNIDVCSSVELYCH
Download sequence
Identical sequences R7U7E8
jgi|Capca1|220759|estExt_fgenesh1_pg.C_360055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]