SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7U9A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7U9A6
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7U9A6
Sequence length 107
Comment (tr|R7U9A6|R7U9A6_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU02559.1, ECO:0000313|EnsemblMetazoa:CapteP133022} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_133022 OC=Capitellida; Capitellidae; Capitella.
Sequence
MRVRNWEARSYNGYSGFGGVLEVYSNGTWGTVCDDGFMDPSARVACRSFGYNHGVAVCCA
AFGWGTDRILLDEVSCSGSEQNIGSCVHNEIGNHDCRHNEDAGILCF
Download sequence
Identical sequences R7U9A6
jgi|Capca1|133022|e_gw1.3419.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]