SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7UD11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7UD11
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7UD11
Sequence length 52
Comment (tr|R7UD11|R7UD11_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU03874.1, ECO:0000313|EnsemblMetazoa:CapteP41913} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_41913 OC=Capitellida; Capitellidae; Capitella.
Sequence
IVVRLVNGANEREGRVEIAHAGQWGTICDDDFGKQEADVICRSLGYRYVLAA
Download sequence
Identical sequences R7UD11
jgi|Capca1|41913|gw1.31440.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]