SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7UHS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7UHS8
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7UHS8
Sequence length 91
Comment (tr|R7UHS8|R7UHS8_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU05633.1, ECO:0000313|EnsemblMetazoa:CapteP145609} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_145609 OC=Capitellida; Capitellidae; Capitella.
Sequence
MGGYVKVYYQGSYHTVCDDDWDDNDARVVCRNLGFSDGVAVCCAAYGSGYEAILLDNVRC
TGSEANLAHCAHNGVYNENCSHSEDAGVLCY
Download sequence
Identical sequences R7UHS8
jgi|Capca1|145609|e_gw1.28.109.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]