SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7UJF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7UJF1
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R7UJF1
Sequence length 137
Comment (tr|R7UJF1|R7UJF1_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELU03392.1, ECO:0000313|EnsemblMetazoa:CapteP96031} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_96031 OC=Capitellida; Capitellidae; Capitella.
Sequence
LFAVRLVEGQASHMGRLEVLYDGVWGTVCGWTFGKAEAMVACRSMGYDDGQLLPLGAPNP
KSDIGPIWLDGVSCYGDEWALEMCYHNGYGRVRYDCTHKWDAWLDCFAENENHNVIDVEG
IEEETNQIEGFEEIFGN
Download sequence
Identical sequences R7UJF1
jgi|Capca1|96031|e_gw1.324.68.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]