SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7Z034 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7Z034
Domain Number 1 Region: 241-420
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.6e-27
Family Glutathione peroxidase-like 0.00091
Further Details:      
 
Domain Number 2 Region: 90-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.18e-17
Family FAD-linked reductases, N-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1-95
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000667
Family PHBH-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R7Z034
Sequence length 421
Comment (tr|R7Z034|R7Z034_CONA1) Uncharacterized protein {ECO:0000313|EMBL:EON67276.1} KW=Complete proteome; Reference proteome OX=1168221 OS=yeast). GN=W97_06529 OC=Dothideomycetes; Dothideomycetes incertae sedis; Coniosporium.
Sequence
MVIPRERIATGDYLTRLYVQVNIEVPADEISGGDILDPATIDADKEARRKARERRAKITL
EGLLQQAQAVFKPYHIKLKDGAEVDWWAAYQIGQRMTERFLQKSSDGVPRVFIAGDACHT
HSPKAGQGMNVSMMDSFNLSWKLAYHLNGLVPPGGQGTNGSIELLDSYELERREIARELI
EFDHKFSSMFSGQIDAEGEEEGLTHEQFVEVFSTGNGFTSGCGIEYPDSDLVLKESANSP
VYGTDFLSGVLRPGRRLLNVRVIRHADGNPRDLQDDFLFTGRFRLLVLTSTDLLDMHGRS
ASALDAIDHIMELYGEDLIELVVLHPIGTNTRDISWEALPRAIKKYAEMSFHSAWDTETP
VGKEHVRRGVYKAEDAYAIFGVSKDQGAICVVRPDGYVGALASLEDVERAERYLTTWLQP
R
Download sequence
Identical sequences R7Z034
XP_007782593.1.34565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]