SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8EM80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8EM80
Domain Number 1 Region: 317-468
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.59e-30
Family HD domain 0.01
Further Details:      
 
Domain Number 2 Region: 209-305
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.42e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  R8EM80
Domain Number - Region: 91-138
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0772
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R8EM80
Sequence length 521
Comment (tr|R8EM80|R8EM80_BACCE) Ribonuclease Y {ECO:0000256|HAMAP-Rule:MF_00335, ECO:0000256|SAAS:SAAS00548727} KW=Complete proteome OX=1053246 OS=Bacillus cereus VDM019. GN=IKK_03504 OC=Bacillus cereus group.
Sequence
MSSSTVWILISILLATVGAVVGFFVRKSIAEAKINGAANEAKRILDEANRDAEALKKEAL
LEAKDEIHTLRTEAELEIRDRRSELQKQENRLMQKEENLDRKDETLDNRERQLEKKEESL
VAKQQQIEELESKVGELVQKQQTELERISNLTREQAKAIILGKVESEVSHEIAVMVKESE
VRAKEEADKKAKEILSLAMQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETL
TGIDLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKSRREVDEYI
REVGEQTTFEVGVHGLHPDLIKILGRLKYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEK
LARRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDTEPTSIIAVL
VAAADALSAARPGARSETLENYIRRLEKLEEISESYEGVEKSFAIQAGREVRILVKPDTI
DDLEAHRLARDIRKRIENELDYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences A0A084J4A9 A0A150C6P8 A0A1I5YK84 A9VS22 C2PZD0 C2SNT0 C2XXP0 J8CXB3 J8IB63 J8IEH6 J8P7G5 J9BSA4 R8CWW2 R8D6M7 R8EM80 R8HZN1 R8MSX1 W4DRV0
WP_002014600.1.10033 WP_002014600.1.100646 WP_002014600.1.100649 WP_002014600.1.11324 WP_002014600.1.17940 WP_002014600.1.20051 WP_002014600.1.20881 WP_002014600.1.21695 WP_002014600.1.27729 WP_002014600.1.27732 WP_002014600.1.28299 WP_002014600.1.2902 WP_002014600.1.2904 WP_002014600.1.30061 WP_002014600.1.31050 WP_002014600.1.35095 WP_002014600.1.36226 WP_002014600.1.37635 WP_002014600.1.37801 WP_002014600.1.38645 WP_002014600.1.39255 WP_002014600.1.39317 WP_002014600.1.39896 WP_002014600.1.4354 WP_002014600.1.4496 WP_002014600.1.45835 WP_002014600.1.47957 WP_002014600.1.50411 WP_002014600.1.54007 WP_002014600.1.57105 WP_002014600.1.60236 WP_002014600.1.63476 WP_002014600.1.6426 WP_002014600.1.68186 WP_002014600.1.68668 WP_002014600.1.72867 WP_002014600.1.75292 WP_002014600.1.76817 WP_002014600.1.79293 WP_002014600.1.82832 WP_002014600.1.8290 WP_002014600.1.85012 WP_002014600.1.85187 WP_002014600.1.86789 WP_002014600.1.87416 WP_002014600.1.93582 WP_002014600.1.99558 WP_002014600.1.99908 315730.BcerKBAB4_3549 gi|163941466|ref|YP_001646350.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]