SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R8MH93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R8MH93
Domain Number 1 Region: 50-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000314
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R8MH93
Sequence length 124
Comment (tr|R8MH93|R8MH93_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EOP33516.1} KW=Complete proteome OX=1053236 OS=Bacillus cereus VD146. GN=IK1_04637 OC=Bacillus cereus group.
Sequence
MINHNKIKQLLAHVDRAEDNEIELECEFEPMTIELFNSEEIEEGQLGYSFDEEGQSLVGN
EEGDWKEGWVVIGIDSYLGDPIFVDSNDENYPVYTAMHGEGDWEPECIAKRIEDVIEKVK
GNVG
Download sequence
Identical sequences A0A0A0WU22 C2SS27 J8PEC9 R8MH93
WP_002034571.1.30061 WP_002034571.1.4496 WP_002034571.1.47674 WP_002034571.1.57105 WP_002034571.1.60236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]