SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9NY05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9NY05
Domain Number 1 Region: 416-546
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000413
Family UBX domain 0.028
Further Details:      
 
Domain Number 2 Region: 218-310
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000716
Family Thioltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R9NY05
Sequence length 566
Comment (tr|R9NY05|R9NY05_PSEHS) Uncharacterized protein {ECO:0000313|EMBL:GAC93544.1} KW=Complete proteome; Reference proteome OX=1305764 OS=Pseudozyma hubeiensis (strain SY62) (Yeast). GN=PHSY_001109 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Pseudozyma.
Sequence
MATPRSAGQQDAIASLRSVLQSSSGSVPDDDMLATLLEVEGWDVTRAARLVEEDSTAERR
RSGADDETIARSFAQDSRIRGSMDLDQSFANTSSPYSASRRAFNAGTGAPSGLPGGAGLR
PHPRGGADGGTMSVAQMIWTALTFPLSIASGILLFLARLLRIRTLFPSLFGGSPGSRTLS
RSDPRTSAENFVRELEQDTGASSSRSAISSEDSATRAPPTMMLPPFFIGGYSDALRTAKE
QIKILAIILVSREHGDVDRFKQTTLTDSDLVELLSRDDFVVWGGDVREREAHQVATTLQA
TTYPFVAFVALQPSRSSSRSSAASSSSSPRAAVLSRLEGSPSTATSAATIASHISDVLLP
RTRTYLDRLRAEKRHREMERQLRADQDRAYQEASRRDAERITQKREEERLKALEVQRQRD
EQERKEQAERKKQAWQRWARHHLVPAEPVASADAVKLSFRLPSGKTLTRRFSPADTVDAV
FAFVETSSVSTDIDGATSQKPQGYEHEFKFSLVTGYPRKRIEAAQAGSTQLKDVDGLAQG
ASLIVEGYVMADKAAAADDETTDEEE
Download sequence
Identical sequences R9NY05
XP_012187131.1.99038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]