SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R9TPB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R9TPB1
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.32e-19
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R9TPB1
Sequence length 140
Comment (tr|R9TPB1|R9TPB1_9BACI) Putative heavy metal transport/detoxification protein {ECO:0000313|EMBL:AGN34461.1} KW=Complete proteome OX=766760 OS=Bacillus paralicheniformis ATCC 9945a. GN=BaLi_c00220 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MWKHFIERLPQDYTLNRPIETEELQKAEELLGVSFPDELVSLLKTTDGINDTFGDHLIWP
AYRMIEENLDMRSTDFFKPFDCLLFIAGAGNGDLFAYSILNGSIRKNDIYVWNHIDDSQI
WVASSLKPFIKGWIDGTITI
Download sequence
Identical sequences A0A0D7XKL5 R9TPB1
WP_020449777.1.17986 WP_020449777.1.26113 WP_020449777.1.74801 WP_020449777.1.80397 WP_020449777.1.97335 gi|511060880|ref|YP_008076198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]