SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S2KB99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S2KB99
Domain Number 1 Region: 70-209
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000159
Family Thioltransferase 0.064
Further Details:      
 
Domain Number 2 Region: 256-389
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000543
Family UBX domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S2KB99
Sequence length 411
Comment (tr|S2KB99|S2KB99_MUCC1) Uncharacterized protein {ECO:0000313|EMBL:EPB89585.1} KW=Complete proteome; Reference proteome OX=1220926 OS=agent) (Calyptromyces circinelloides). GN=HMPREF1544_03669 OC=Mucoraceae; Mucor.
Sequence
MHHEHDSPSSTSALLGNNTNTSSTRSSNKRFLWIFMWPFSLAWRIIASLFQFTARLLYKP
SITGPRRDARTEADRFLRDFESTYGTTHPAFFSEGGYTQALKAAKHELKYMLVILCSEEH
DDNDTFCRETLTDVELLDFLRQNQVICWAGNVRYTEAYQVSNTLQATTYPFLAIIALQQT
NGVSKMSVIDRIEGPISASSIIRRFDSVIVRIGHSLDHLRAERAQREAERRLRQEQDQAY
RESLNADQRKRELLQKKKEAALKAKQAKEILARKRQQYIRYLCQHALKRDIAPDQKTTRI
SFRLSNGDRVIRQFSGDDTLVSLYEYIEAYSHMDSMTSSDYESVSLPEDYVHQYKFSMHS
PFPKTVYLPDPTRKIIDEKGLWPSATLIVDTNEEEDEEEEDSQDSNEEDVD
Download sequence
Identical sequences S2KB99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]