SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4R168 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4R168
Domain Number - Region: 11-66
Classification Level Classification E-value
Superfamily Ras GEF 0.000889
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4R168
Sequence length 74
Comment (tr|S4R168|S4R168_MOUSE) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 {ECO:0000313|Ensembl:ENSMUSP00000138098} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Plce1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLKERQLGTSMANSNPVPSSSAGISKELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMD
YLCFLTRDLSSPEC
Download sequence
Identical sequences S4R168
ENSMUSP00000138098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]