SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RCL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RCL5
Domain Number 1 Region: 38-66,108-180
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-21
Family Voltage-gated potassium channels 0.0067
Further Details:      
 
Domain Number 2 Region: 213-313
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-18
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4RCL5
Sequence length 462
Comment (tr|S4RCL5|S4RCL5_PETMA) Potassium channel, subfamily K, member 13a {ECO:0000313|Ensembl:ENSPMAP00000002947} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
LTEKSPRSAPRPATQNSAPRPATQTTMARVSLGGEDTARFALLAALILCYLLCGAAVFSA
LERPSELVAQERWLHRLENFTQHFGVPRADLDALLRDFELGATAGVRAAPLRPRWDFTGA
FYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFGCAAGILFFNLFLERLITLLACVMRSC
HRRQINRLVIQPGRKASDQSDAIECLAGWKPSVYHVMMILGIAAVAIACSASAMFSAVEG
WSYVDSLYFCFVAFSTIGFGDLVTGQRDLYDHQTWYRVGNIVFILAGVCCIYSLFNVLSI
VIKQTLTWMLHKADCRSLCRRRPRLRARNQRRNAVMPGVPRGRRNNNNNDAAGGGGGGGG
VETVAAPGPRRYDGGAGNDSDTDGRRLSGELISMKDFLASNKVSLALMQKQLSEAANGHH
HRVAHRCSPVHSHSLGRENGFAAGVGALAIMNNRLAETSEDR
Download sequence
Identical sequences S4RCL5
ENSPMAP00000002947 ENSPMAP00000002947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]