SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RI98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RI98
Domain Number 1 Region: 33-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-50
Family SPRY domain 0.000000334
Further Details:      
 
Domain Number 2 Region: 234-271
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000759
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4RI98
Sequence length 272
Comment (tr|S4RI98|S4RI98_PETMA) SplA/ryanodine receptor domain and SOCS box containing 2 {ECO:0000313|Ensembl:ENSPMAP00000004930} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN=SPSB2 OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
MGLGLGKAIKSVLGKDFDLEIFRLEPPGERTMPPQLAFLLSQPAAPRGLQVQHGFSSTDL
SPSMSLKEGDALTVHRRPMRDTTDAARGRTAYRRGVHTWEITWPTEQRGTHAAVGVATSD
APLEATGYVALVGRGRESWGWDLGRCKAYHGAVDSPGRPYPAHLLPCESFHVPERLVMAL
DMEEGTLSFVVDGEYLGVAFSGLRGKTLYPAVSAVWGNCEIKMRYINGIEPGPLPLDELC
RRSIRNCLGNDRLEEINALPLPTLIKRYLHYN
Download sequence
Identical sequences S4RI98
ENSPMAP00000004930 ENSPMAP00000004930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]