SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RIH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4RIH2
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily HR1 repeat 0.00811
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RIH2
Sequence length 270
Comment (tr|S4RIH2|S4RIH2_PETMA) Rhotekin 2b {ECO:0000313|Ensembl:ENSPMAP00000005004} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
QDAGLQARIEREMRVREGACRLLAACSRAEQALDAARSLLVCDARVLACMAELQRRQEAQ
VLRRAQRRSSDGGPQERVSCTGTVAITDIRIPLMWKDTQHFKNKGGVAESPRHAVFCLLR
LGSEIVDTEMVLVDRSVTDVCFEAPAVFREASPAFRLRVEVYSCCAAEESCRVGGGAAGT
QVGPRGLAGRISGSLGRSAGRRARAALDTSPRGDAGASGTAAATSPPVTTVSSVSLSGPK
YQLLAHTSLTLDDVQDGFRTHDLTITATGE
Download sequence
Identical sequences S4RIH2
ENSPMAP00000005004 ENSPMAP00000005004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]