SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RJE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RJE4
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-22
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 221-266
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000706
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RJE4
Sequence length 271
Comment (tr|S4RJE4|S4RJE4_PETMA) Ankyrin repeat and SOCS box containing 4 {ECO:0000313|Ensembl:ENSPMAP00000005326} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
CVRARACAGADVNLETGNAAEEMPLHTAARCGLPEHTALYVSHGAEVDGSDGHDETPLCT
AIFWALSMRNMCVSPQHHKVCERLLTLGADPNGVDTDRKSALHRAAWNADCTLLELLLSA
GAHVNQLDGLGCTALQYIVRVVSVRPTLQPERCIQMLNHGSVSIYPLQFHKVLELCGNSP
AAVEILVNSYKQLRITHAWAPALSQDAREAHRDFYASLLHFCNGVPRSLLHLSRCAIRGV
LGERCHCQIPRLPLPARLRDYLLLNPEGIIY
Download sequence
Identical sequences S4RJE4
ENSPMAP00000005326 ENSPMAP00000005326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]