SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RMN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RMN0
Domain Number 1 Region: 97-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-35
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 2 Region: 274-382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 215-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 387-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 41-106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  S4RMN0
Domain Number - Region: 5-35
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000144
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RMN0
Sequence length 444
Comment (tr|S4RMN0|S4RMN0_PETMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSPMAP00000006466} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
GETLPLSSGNQITLTFTSSHDASGKGFHFVYQAVPRTSSDQCSSVPEPKFGQRLGNSFSV
DSVLRFECNSGYILQGARAIQCQKVPNSLAQWNESYPTCVVPCGGNLTELKGAILTPGFP
EPYDNNLNCVWKITVPEGAGVKMHVFSFATEQNWDALEIYDGGDANSPRLGSFSGTSIPA
VLNSTSNSLYLHFHSDISVSAAGFHIEYTAVGLASCPEPELPTNGVKVGDRYLVNDVVMF
QCEQGYTLQGPTHATCMPGPVRRWNFPPPLCIAQCGGVLTELTGVILSPGFPGNYPSNLD
CTWKVLLPMGYGAYFAFVNFSTEPLHDFVEILSGPPEAQEAIGRFSGARPPAPALSTTHD
TTVHFQSDYSQNKQGFRLSFQAYQLSSCPDPNPFRNGLVMGAEYTVGSSVSFRCLPGYTL
VGHPILSCRHGRSRNWDHPIPTCQ
Download sequence
Identical sequences S4RMN0
ENSPMAP00000006466 ENSPMAP00000006466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]