SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RNA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RNA0
Domain Number 1 Region: 444-581
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-27
Family Netrin-like domain (NTR/C345C module) 0.031
Further Details:      
 
Domain Number 2 Region: 222-318
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 397-450
Classification Level Classification E-value
Superfamily BPTI-like 2.7e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 336-393
Classification Level Classification E-value
Superfamily BPTI-like 1.22e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0084
Further Details:      
 
Domain Number 5 Region: 135-185
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000956
Family Ovomucoid domain III-like 0.037
Further Details:      
 
Domain Number 6 Region: 42-92
Classification Level Classification E-value
Superfamily Elafin-like 0.0000011
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4RNA0
Sequence length 585
Comment (tr|S4RNA0|S4RNA0_PETMA) WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 {ECO:0000313|Ensembl:ENSPMAP00000006686} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN=WFIKKN2 OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
VCVVSGTAMATQAGGASRTSLLLLALAFVPRQGFGATLPTDKPRYHVGVCPNDLNPNLWV
DAQSTCEKECGGDQDCTAFEKCCLNVCGSKSCVAARFAESKKRPAGSPGGRDAAAGAKAA
ASCAGFACQQQGAECELWDGKPACRCRDRCEKEPDFTCASDGLIYYNRCYMDAEACVKGV
ALGVVTCKYHVAPPPRPSEPPSETAAPPTVRHPPLTPPGDAVPPALLSNPYPQEVALGGT
VSFRCDVGGRPQPDVTWEKRSDGRDNLIMRPDQMYGNVVVTNIGQLVIYSAEEHDAGIYT
CTASNAAGLLRANFPLSVVTHDRPRQPPPDGAIAEFPASECHEPPDVTHCGSARTKWYYD
SGLNACDTFVYGGCDSNRNRFDTYEGCKRWCQNQTVNICHLPPVQGPCRDWERHWAYNPL
IKQCQLLVYGGCEGNENNFESREACEDNCPFPTKAALCKSCKPRQKIVPSFCKSDFAIVG
RMTELVEEPDSGYARFTVDEVLKDDKMGLKLFNTKHMEVTLANVDWSCPCPNMTASDGAL
LVMGEVQDGMAVLHPHSFVRTASERRVRKVFETIEKKTCDLMRRF
Download sequence
Identical sequences S4RNA0
ENSPMAP00000006686 ENSPMAP00000006686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]