SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RPT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RPT5
Domain Number 1 Region: 15-211
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.3e-59
Family Astacin 0.0000726
Further Details:      
 
Domain Number 2 Region: 647-755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 3 Region: 334-436
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-36
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 4 Region: 483-593
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-36
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 5 Region: 218-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-36
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 6 Region: 777-870
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-30
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 7 Region: 594-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000698
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 438-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000164
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RPT5
Sequence length 881
Comment (tr|S4RPT5|S4RPT5_PETMA) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
AAKRRFRSRAPRAATARSERIWPGGVIPYIVGGNFTGSQKAMFRQAMRHWEKHTCVTFIE
RTDEESYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRP
DRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTFSRGIFLDTILP
RPDDSGVRPAIGQRTRLSQGDIAQARKLYRCPACGETLQESVGNFSSPGFPNGYPSYSHC
VWKISVTPGEKITLNFTSLDVFKSRLCWYDYIEVRDGFWRKAPLLGRVCGDKLPEPLVST
SSWMWIEFRSSSNWVGRGFSAAYEAICGGEVNRENGQIQSPNYPDDYRPSKECVWKISVT
EGFIVGLTFQAFEIEKHDNCAYDYLEVRDGDNDSSQLIGRYCGYEKPDDIKSSSNKLWMK
FVSDSSVNKAGFAANFFKEIDECARPDNGGCEQNCVNTLGSYRCACDPGYELAPDKRSCE
AACGGFLNKLNGTMTSPGWPKEYPPNKHCVWQVVAPAQYRISLQFEFFELEGNDVCKYDY
VEIRSGLSSESKLHGKFCGTELPDVITSQNNNLRLEFKSDNTVSKKGFKVHFFSDKDECS
QHNGGCQHDCINTLGSYSCQCRNGFMLHENGHDCKEVSTAGCEHKINSAEGVISSPNWPD
KYPNRRECTWEISATPGHRVKLTFSEFEVEQHQECAYDHLEVYDGSSEKAPILGRFCGSK
KPEAVLSTLNKMYLRFMSDASVQKRGFQAIHSTVCGGKLRADVAPRELYSHAQFGDNNYP
GQLDCDWVITAEDGYGVELTFLTFEIEEEADCGYDYMELYDGYSADALRLGRFCGSGPPE
EVYSSGDSIMIRFHSDDTIGKKGFHARYTSTKFQDALHAKK
Download sequence
Identical sequences S4RPT5
ENSPMAP00000007221 ENSPMAP00000007221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]