SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RQP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RQP1
Domain Number 1 Region: 201-354
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000129
Further Details:      
 
Domain Number 2 Region: 356-519
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.04e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000066
Further Details:      
 
Domain Number 3 Region: 67-191
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-27
Family Spermadhesin, CUB domain 0.0000341
Further Details:      
 
Domain Number 4 Region: 559-724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-22
Family MAM domain 0.0026
Further Details:      
 
Domain Number 5 Region: 4-61
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000301
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4RQP1
Sequence length 878
Comment (tr|S4RQP1|S4RQP1_PETMA) Neuropilin 2 {ECO:0000313|Ensembl:ENSPMAP00000007527} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN=NRP2 OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
LSSRFDYVEVRDGRDTNAEVLGKFCGNIPPSALVSSGPVLYIHFQSDYSTQGAGFSLRFE
IQATADECSHMFTAPNGSLQSPGFPEPYKHNLECTYIIKASVPRSEIVLKFHTFLLEGDQ
PGTAGIPVDATECRYDRLEIWDGPPRGGPLLGRFCGAMSPGEVRAFSGILSLSFYTDGGI
ALDGFWATYRVIPRRIIESVQCNQPLGMESGKVEVDRIVASSTHSSRMWQPWQARLHNPI
NGWTPSRDDPREWIQVDLGSLKLLSGVATQGAVSHESQIGYFVSSFRLEVSSLGADWTVL
RGSRAVKAFAGNVDATSVVENRLAEPVLTRFVRIRPQTWEGGIALRFELYGCSLADFPCL
ETLGVGQGHVPDNALSASSQWSPPWGAHAARLLAPQRGWAPHMAGLFSFDEWLQVDLGSL
FTVRGVILQGVRGDLGTQDKPEGPLFVKKFRVGFSEDGDTWHMVTDDESSQPKIFNGSSN
VDLPEMRKFEPVEARLVRVYPERWSPHGIGLRLELLGCQSLGRERRAAPVSAECHWTAQH
GIDTTLRKPLPTAESTGVPGFNCEFHLGADGGMCSWIQDDQADLHWLLGDAEVEGEEEDI
HHDKGDGCVWINTLGRAAGERARLLSVPLPSHAQPRCLAFRYRLHGDTLATSAGVDSLRV
LTRTQTPMGMREQLVWSLTGVQGREWRLAHAVLPINYGPYQVILEGEVGAHPSGSVAVDD
IRIAFEIPIEDCQKPHISIVETDTTSGNIRAIGEKHRLRAQETQSQQHKTCISSWPKMFK
NIIVSRINELSKNLNRALDPILISVIIVSTMGVLLGAVCIGLLLCCAPARRAASIGVVGT
RGYRGAPAATLDAYAFELCNGARFVDKSNGQHKLSSEA
Download sequence
Identical sequences S4RQP1
ENSPMAP00000007527 ENSPMAP00000007527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]