SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RRI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RRI1
Domain Number 1 Region: 226-266
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4RRI1
Sequence length 267
Comment (tr|S4RRI1|S4RRI1_PETMA) Neuralized E3 ubiquitin protein ligase 2 {ECO:0000313|Ensembl:ENSPMAP00000007817} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
AYEKFHVVHGGNMHMDSTRTHATRVRSFGDAVCMSAQPLPPGRVFLVELSQKETGWCGHL
RVGLTRLCPGGSDGLSRQRQPKIVVFGKSWVKYELKNHLTKAIGTACSMPCCGHALRGAH
VTTFTVDVWLYVGNHVIVRDSLVGRSRVGRYSHLLDPLFKTHILSTTARGTRIGVIWRIL
EEEGVMHLLVNGRDLGVFARGIPTHTPIFAVVDVFGCTRAVTVLHVEYAVPSLQTICRRM
IQKLTVNRLAISRLGLPAALQCYCQYK
Download sequence
Identical sequences S4RRI1
ENSPMAP00000007817 ENSPMAP00000007817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]