SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RS02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RS02
Domain Number 1 Region: 251-367
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-32
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 6-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-26
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 135-248
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4RS02
Sequence length 532
Comment (tr|S4RS02|S4RS02_PETMA) CUB domain containing protein 2 {ECO:0000313|Ensembl:ENSPMAP00000007989} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
RRAVKCGGVLSSRAGHVRSPRHPAPYPALADCLWLLVAPAGARLTLAFSAFSLEPHPACA
YDALTLWDGQPGTAGALRGRYCGERGRNGSEEAPRPPGVIPPAALISSGHVVGLQFHSDK
HVSRSGFLIAFDTEDCGGPLSGPSGSFASPAYPSHYPNGADCVWALGHSAASVTALAFRD
LLLEEGEGCGFDYVAVYAGGEEAGGDGSERCFNGTDLPTFVSPPGRRLLVVFHSDYNIGA
RGFLAEYHTDECQRTLTALQGDVHSPRYPGPYPGGVRCRWLLAVPPPLRLRLSFRDFHLE
ESDERGHCGYDQVALFDGETENENSSLGRFCGSRMPPATTSTSSKLLITMHTDSSEALRG
FSLSYTAVVPMTVACGESGFRATLPTELPAGVRLLSARLRDPACSSAPSGSTLRIEANYS
ACRTKEATLRNKRFIIRSTFIFFYDLDYKNDIYYLQYFPLRFRSCHHRISFAAPLRCDGQ
TRRPPNRAAQQRAAAPTLDGVRSDDTSGVLFITICVLACVLMFAAAIAFFIL
Download sequence
Identical sequences S4RS02
ENSPMAP00000007989 ENSPMAP00000007989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]