SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RU12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RU12
Domain Number 1 Region: 122-249
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.63e-30
Family Spermadhesin, CUB domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 11-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4RU12
Sequence length 249
Comment (tr|S4RU12|S4RU12_PETMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSPMAP00000008702} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
TCGGPVTVLGPGNISSPGFPNEYLPRQHCEWVLRAPGPDQRLSVIFNPHFDLEGHNCRFD
YVELRDGDGPSADIIGRYCGMVAPGLLVSSGSALFVRFESDYAHQGAGFSLHYEIHKSGS
DDCSWNFTAPSGVLSSPGFPDKYSHYLECTYTVWAGPRRDLVLRFTHFHVEGVSRGPPGA
GPNPHLAGGVTDCPYDRLEVWDGLSNVGPLIGHYCGRRAPWVLRSSTGVLSLRFFTDAAV
ARDGFSANY
Download sequence
Identical sequences S4RU12
ENSPMAP00000008702 ENSPMAP00000008702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]