SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RUF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RUF5
Domain Number 1 Region: 760-867
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-33
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 2 Region: 61-176
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-32
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 3 Region: 596-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 4 Region: 407-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-26
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 5 Region: 234-355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-25
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 6 Region: 182-242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 873-938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 8 Region: 701-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 526-591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 10 Region: 6-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000473
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 355-417
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 934-969
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000017
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RUF5
Sequence length 970
Comment (tr|S4RUF5|S4RUF5_PETMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSPMAP00000008845} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
FGYNECHDPGIPINSRRFGDSFTLGKSVFFVCENGFMRTQGYESITCVLQDGNIHWSSTI
PKCEAPCGSHLTAPSGTIFSPGWPSSYKDSLTCEWVIEVNKGNAIKITFQSRFQTEPNYD
VLEVHDGSSAYSPVLGAFHGTQVPLFLVSSGNHLFLLFTTDSSHSGMGFQLHYERVTWDA
HSCPDLPVPVHGRRLGGDFSIGSSVEFSCEPGFSLSHDLPLTCQDNHQWTQQLPTCDALC
GGYIKASTGTILSPRFPNFYPNSLNCTWTVEVSHGKGVKFTFHTLHLESQHDYLLVTESG
SFASPLARITGAALPPPLSAGMLGNYQAQLRFVSDFSMSYEGFNITFSEYELEPCRDPGV
PALGSRLGSGLLVGDAVVFLCDAGYRLEGAARLVCLGGGRQAWSAPLPRCVAECGTSLRG
DDGVLLSPNYPLVYGNNHECVYDIAVAPGHGVQLAAVHFRLGRGDALTVYDGLDGSSRVL
GDFTGTAMQDSIINSTSNHLHLEFNSDGDVVDGGFRLVYTSFELLRCEDPGVPEFGHVVA
DEGHFAGSSVTFGCDPGYTPHGRTVVTCLTGERRVWDFPLPSCLAECGGAIAGVSGGTIL
SPGYPNAYEHNLHCEWTIEVNPGFTISLHFQVFDTEASHDELRIWDGSAESGILLRELSG
PVLPDTVHSTLHLVTLHFNTDFFISRPGFALRFTSSVASECRDPGVPTNGSRSGDGRRPG
DSVLFQCDPGYALQGPPRMTCVQAESRFFWQPSLPICVAPCGGNLTGPAGFILSPNYPQP
YPPSHECHWTITVNEDFVVALSFLSLNLEANYDFLHAYDGGDVLAPLLGSFHGLQLPGRV
ESGGNVMHLAFHSDKTINAGGFHIEYREKPRESCFDPGSIANGSRLGSDLRLGSSVTFSC
GTGYSLHGYSTLLCIMGDDGRPAWNRPLPACRAPCGGHSTGQEGSILSPNYPGNYSVMQS
CFYSVTVPNE
Download sequence
Identical sequences S4RUF5
ENSPMAP00000008845 ENSPMAP00000008845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]