SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RUV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RUV8
Domain Number 1 Region: 902-1210
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000113
Further Details:      
 
Domain Number 2 Region: 1176-1466
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-64
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000455
Further Details:      
 
Domain Number 3 Region: 23-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-39
Family MAM domain 0.00000422
Further Details:      
 
Domain Number 4 Region: 385-582
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-25
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 281-413
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000525
Family Fibronectin type III 0.006
Further Details:      
 
Weak hits

Sequence:  S4RUV8
Domain Number - Region: 197-278
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0183
Family I set domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RUV8
Sequence length 1469
Comment (tr|S4RUV8|S4RUV8_PETMA) Protein tyrosine phosphatase, receptor type, U, a {ECO:0000313|Ensembl:ENSPMAP00000008998} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
RRGSQELLITLLEVVVTALLLCIAGSCSFEDDFGACGYRQDTDDTFDWEQVNAREFPELE
GAIPHADVDTYMLANTSDRVPGQWATLRLPQIKKNDTHCLDFHYHLSAPGRLSPGTLNVY
VAVNGGPLANPIWNASESMGRRWARAELAISTFWPNSYQVIFEAVSSGVELGYIAIDDVQ
VHSYPCSKIRRFQQRTADAFVTFETFATGKALTNELLWLQRSNGQDIPVSGTKLVNHRRF
AASFGVPYAARSHADIYRCVTGSADGAGVSNFAQLIVKGSEPPTPVAPPQLVGAGATYLL
VQLNANSIAGDGPVVLREVEYRLPASVGGWAETHAVNAATYKLWHLDPDTRYEVRVLLTR
PGEGGTGKSGPPLLARTKCAEPTRPPRGLLVTSVGSRKLSVEWERVGYNVTRCSNFSVAV
RCRYRRGGGGGGGGGGSGEALRVLAQHTLYDLPPFTNISVRLVLSNPEGRKESEEIVTQT
DEDVPGPIPEDSIRGDTFEDRIFLQWSCPTETNGLISLYEITYQAVSSFDPSLVAAARSG
VIHRASNETAHLFSGLFPGTSYAFTLRASTVKGYGPPVTVRLSTNISAPTLPRYEFDEPL
NETDTTITVLLQPAASKGAPVSAYQLVVKENRQQQQQQQKPRASCFFEPIGFQAASARDS
PHYFAAELPPAALPSPSRFVVGDNRTYNGFWNAPLTPEKSYDVYFQAVSQSAGEIKIDCV
RVGRKGASPRPPSAPAPERQMDHTMRVAGIVAGSLALILVVMALLIIFRRRKMSKKRKEG
GNGGSRQEMTLMVHAMDKSFVEQSALHGEEPLAFLNAHNGTGRFVKKKSSKTCRTNALRT
EQRHNTSSDYFLTPLSLLLPLVSPDSVSIAVSATYRHRRPRDGPDSPAYHTGRLHPAVRV
ADLLEHIGQMKTGEGYGFKEEYESFFEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVML
NVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVE
VGRIKCCKYWPDGSDVYGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWP
DHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVID
IYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSS
SNHIKDEFQTLNMVTPPLRVEDCSIALLPRNHEKNRYHDVLPPDRCLPFLITINGDSSNY
INAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWPEE
GMLCHGPIQVEFVAFNMEGDIITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRH
SFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEK
IMAIYKGLVNLQSQYQFCYDVALEYLETV
Download sequence
Identical sequences S4RUV8
ENSPMAP00000008998 ENSPMAP00000008998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]