SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RX17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RX17
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.21e-34
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 282-333
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000654
Family SOCS box-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4RX17
Sequence length 343
Comment (tr|S4RX17|S4RX17_PETMA) Ankyrin repeat and SOCS box containing 15b {ECO:0000313|Ensembl:ENSPMAP00000009757} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
QAEDAATVLYEASSHGHIDCITLLLQHGANPNIPNATGHLPIHRAAFKGHVRAVKQLLLE
TRERAVERSGVSPLHSAVAGGRVDCLKVLLESGYDPDFLLADHVAVNYTDNRRSALFFAV
CNGDMEATKLLLQAGAKVNQDPMNALLVAMHRGDRETVALLLRHGANVDCQMVVNTTRFP
AALQYAFKDESLLRALLDAGCDARLCFECSHDAEGRRPSGPRDLPGWSSSIIQDTEMCEM
LTLSWVEHLAGRVVRVLLDYVDFVPICVKLKAVLRKHPEWEQISHILENARPLKHLCRLV
IRERMGTLRLRSPAFLERTFLPRSLREYLLYMERGQSIEQGLS
Download sequence
Identical sequences S4RX17
ENSPMAP00000009757 ENSPMAP00000009757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]