SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4RXH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4RXH2
Domain Number 1 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 101-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  S4RXH2
Domain Number - Region: 141-177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0367
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S4RXH2
Sequence length 177
Comment (tr|S4RXH2|S4RXH2_PETMA) Low density lipoprotein receptor class A domain containing 1 {ECO:0000313|Ensembl:ENSPMAP00000009913} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN=LDLRAD1 OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence
GGCQRWCTQRCVCLFIICLLVVAAVAVAVALGVVYGVPKISGGKLNRECQTTLNQSGFLC
DDRVTCISPSKVCNQRSDCTGGADESKQYCSDPVNTLPSSIIFLCGDGKTWTYTDKLCDM
HNDCGDCSDETGTVSQCPVCGGWRCSTVFFQDCDCIPTTRCRDSVQDCVNWSDEINC
Download sequence
Identical sequences S4RXH2
ENSPMAP00000009913 ENSPMAP00000009913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]