SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4Y062 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S4Y062
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily FnI-like domain 0.00586
Family Fibronectin type I module 0.013
Further Details:      
 
Domain Number - Region: 37-105
Classification Level Classification E-value
Superfamily Cyanovirin-N 0.068
Family Cyanovirin-N 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S4Y062
Sequence length 138
Comment (tr|S4Y062|S4Y062_SORCE) Uncharacterized protein {ECO:0000313|EMBL:AGP38872.1} KW=Complete proteome; Reference proteome OX=1254432 OS=Sorangium cellulosum So0157-2. GN=SCE1572_32920 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MALLSGCGDSDAERIEQQRETWNEKHVTSYVVETCATGFSAGCRRVAVEDGQVVAAREKS
PNDNSPWSDIDDLTNVDEPIAWMFDRAEGTPDDCELSQLSFDPQFGFIREYYVSCSVEGS
GERVTCFAPDTVDLAACE
Download sequence
Identical sequences A0A150P4B4 S4Y062
WP_020738488.1.94496 gi|521465726|ref|YP_008152969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]