SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S4Y1X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S4Y1X6
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000667
Family Pentapeptide repeats 0.019
Further Details:      
 
Weak hits

Sequence:  S4Y1X6
Domain Number - Region: 193-248
Classification Level Classification E-value
Superfamily FnI-like domain 0.1
Family VWC domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S4Y1X6
Sequence length 277
Comment (tr|S4Y1X6|S4Y1X6_SORCE) Uncharacterized protein {ECO:0000313|EMBL:AGP38799.1} KW=Complete proteome; Reference proteome OX=1254432 OS=Sorangium cellulosum So0157-2. GN=SCE1572_32540 OC=Sorangiineae; Polyangiaceae; Sorangium.
Sequence
MLPEDAAEEPVDADEQAAIMGNGLTFNGLTFNALTFNGLTFNALTFNGLTFNALTFNGLT
FNALTFNGLTFNALTFNGLTFNALTFNGLTFNGPVMAALSDPLGRQQLSAIVGCALPKGE
AIRLNIEGVDYSFQGSTGLAPEWGKPGGACGEDCKSWVSACVISRVNYLGQSVQISVRGK
DKALASTREEREGYTRREGAYFGDIFATPQKLHACVAPGATQIPRVCGPSIRDCSPIEVL
GACDDVCDHELGDGAFDKCRDRSGKMQKAAVTVFLAR
Download sequence
Identical sequences S4Y1X6
gi|521465653|ref|YP_008152893.1| WP_020738412.1.94496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]