SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S5C2D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5C2D0
Domain Number 1 Region: 7-252
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.85e-25
Family Nuclease 0.051
Further Details:      
 
Domain Number 2 Region: 260-424
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.47e-20
Family Nuclease 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S5C2D0
Sequence length 738
Comment (tr|S5C2D0|S5C2D0_9ALTE) Phospholipase D {ECO:0000313|EMBL:AGP98865.1} KW=Complete proteome OX=1300258 OS=Alteromonas mediterranea UM7. GN=I635_16820 OC=Alteromonadaceae; Alteromonas.
Sequence
MQSGKSIFQPGQNCWVESKARFSTPLIDCGNYYKALHSSIVKARHSIFIVGWDIDSRIRL
LRGDDEANSEAPSVISDLLKWKAEQLPDIKIYLLRWDSSLAFFAQREMWAKEVWEEKTPD
NVQTELDGTIPMGGSQHQKIVVIDDELVFSGGMDVSTNRWDTRDHPVVSEERDGPDGEYG
PLHDVQMVSSGPVVEDFAKLVRWRWQRVAEESPIDMREDARIDDNAPLPDAWPEDYPPLF
ENVECALARTIPFMDEVEPAQEVRHMLLDLIGEAESVIYIENQFTTRQEIAEALNKQLKL
KPNLSVIIVSSYEPKGKFECEAFWASRIEFKAILEKGIDPERVKLTYSSIEDMQGRRAYK
RIHSKVMTIDNKYLVIGSSNLSNRSMTLDTEIDTVLFGNSKENQACIEQVRNDLLAEHTG
RDIADMPAIFDNDSPVEALMQGQIAHGYVLTEVRDEVFTEHSGQNMFRALSDPEEPLISV
PTFDGAALPARNPRRRSIMILIGLAIIAVLGGLMFWASQSIPWLSSDSINTFLEKSRGTY
FALPTVLLVYVVGGILFFPVTVLSLAVAAIFGPIWGPIYGIMGALMSSAIMFGVGKLSGN
AGLRKIGGPKVAAVDEKLKRSGIVGVAAIRMLPVAPFSLVNLVAGISSIGIFQFLVGTFL
GMFPPMIAKGLVGDSIAQIWQNPSPETISYLVGGIVLWGLMIWGSQKFARFYQARKEAKS
DSENEDSSSKSEVKKCAA
Download sequence
Identical sequences S5C2D0
gi|522615577|ref|YP_008181267.1| gi|410862972|ref|YP_006978206.1| WP_015068060.1.24997 WP_015068060.1.30323 WP_015068060.1.68468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]