SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S5PZP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5PZP2
Domain Number 1 Region: 630-778
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-47
Family Toll/Interleukin receptor TIR domain 0.0000000388
Further Details:      
 
Domain Number 2 Region: 30-164,353-540
Classification Level Classification E-value
Superfamily L domain-like 3.57e-40
Family Leucine rich effector protein YopM 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S5PZP2
Sequence length 786
Comment (tr|S5PZP2|S5PZP2_9PRIM) Toll-like receptor {ECO:0000256|RuleBase:RU363040} OX=9593 OS=Gorilla gorilla (western gorilla). GN=TLR1 OC=Catarrhini; Hominidae; Gorilla.
Sequence
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIRVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFRFNQELEYLDLSHNKLAKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSSLTLNNIETTWNSFFRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFSFPQSDIYEIFSNMNIKNFTVSGTPMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKVRSIKAGDNPFQCTCELREFVKNID
QASSEVVEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIITIGATMLVLAVTVTSL
CIYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNNLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK
Download sequence
Identical sequences S5PZP2
ENSGGOP00000012870 XP_018880447.1.27298 XP_018880448.1.27298 ENSGGOP00000012870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]