SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S5Q812 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S5Q812
Domain Number 1 Region: 483-780
Classification Level Classification E-value
Superfamily L domain-like 1.26e-44
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 869-1021
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.75e-36
Family Toll/Interleukin receptor TIR domain 0.0000976
Further Details:      
 
Domain Number 3 Region: 119-353
Classification Level Classification E-value
Superfamily L domain-like 3.23e-36
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 4 Region: 357-434
Classification Level Classification E-value
Superfamily L domain-like 0.00000000635
Family Ngr ectodomain-like 0.056
Further Details:      
 
Domain Number 5 Region: 61-97
Classification Level Classification E-value
Superfamily L domain-like 0.00000181
Family Ngr ectodomain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S5Q812
Sequence length 1040
Comment (tr|S5Q812|S5Q812_PANTR) Toll-like receptor 8 {ECO:0000313|EMBL:AGR83553.1} OX=756884 OS=Pan troglodytes ellioti. GN=TLR8 OC=Catarrhini; Hominidae; Pan.
Sequence
ENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLREVPQTV
GKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAF
LNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNC
YFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEED
FKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRK
INAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINISK
NFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLE
IIYLSENRISPLVKDTRQSYANSSSFQRHILKRRSTDFEFDPHSNFYHFTRPLIKPQCAA
YGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNR
LDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTD
KYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLN
LPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSH
NRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIG
DFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITTM
VMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINEL
RYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFY
LALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNV
VLTENDSRYNSMYVDSIKQY
Download sequence
Identical sequences D7NVR3 S5PR55 S5Q812
ENSPTRP00000047493 ENSPTRP00000047493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]