SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7NFX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7NFX1
Domain Number 1 Region: 510-879
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.14e-127
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.85e-29
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Domain Number 3 Region: 455-495
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000275
Family WW domain 0.00011
Further Details:      
 
Domain Number 4 Region: 167-210
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 327-367
Classification Level Classification E-value
Superfamily WW domain 0.000000000000473
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 403-439
Classification Level Classification E-value
Superfamily WW domain 0.00000000000459
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7NFX1
Sequence length 886
Comment (tr|S7NFX1|S7NFX1_MYOBR) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:EPQ16339.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10006264 OC=Vespertilionidae; Myotis.
Sequence
ENVRIVRVKVIAGIGLAKKDILGSSDPYVRVTLYDPMNGILTSVQTKTIKKTLNPKWNEE
ILFKVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPVKNPRMERPYTFKDFVLHPRS
HKSRVKGYLRLKMTYLPKTSGSEEDNEEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPP
GWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETE
SVDNRESSENWEIIREDEGILYSDRAFSSPPPSSNSDVQTHLAEELNALLTVSGNSAAGQ
PVSSSNHSSRRGSLQAYTFEEQPALPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRTTT
WTKPTVQATVETSPLPASQSFSASPQPQVPTSDSAQQVTPPAEMEQGFLPKGWEVRHARN
GRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDSSNDLGPLPPGWEERTHTDGRIFYINH
NIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKLEMKLRRATVLE
DSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATD
NYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDM
ESVDSEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELKVGGSEIVVTNKNKKEYIY
LVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKY
KNGYSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQ
WGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQVAIENTQGFDGVD
Download sequence
Identical sequences S7NFX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]