SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7NNU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7NNU3
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily L domain-like 3.74e-53
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 2 Region: 425-682
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.2e-23
Family Rhodopsin-like 0.0079
Further Details:      
 
Domain Number 3 Region: 235-337
Classification Level Classification E-value
Superfamily L domain-like 1.02e-22
Family Ngr ectodomain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S7NNU3
Sequence length 741
Comment (tr|S7NNU3|S7NNU3_MYOBR) Leucine-rich repeat-containing G-protein coupled receptor 5 {ECO:0000313|EMBL:EPQ18861.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10034064 OC=Vespertilionidae; Myotis.
Sequence
MLLRVDCSDLGLSELPANLSVFTSYLDLSMNNISQLPPSPLHSLRFLEELRLDANHISYV
PPSCFSGLHSLRHLWLDDNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLV
VLHLHNNRIHSLGKKCFDGLHSLETLDLNYNNLDEFPTAIRTLSNLKELGFHSNNIKSIP
EKAFVGNPSLITMTLNGASQITEFPDLSGTGSLESLTLTGAQISSLPQTVCDQLPNLQML
DLSYNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIVHPSA
FSTLPSLRKLDLSSNRLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAY
QCCAFGVCENVYKISNQWNKGDNSSTDDLHKKDAGMFQVQDERDLEDLLLDFEEDLKALH
SVQCSPSPGPFKLCEYLFGSWLIRIGVWTIAVLALTCNALVTSTVFRAPLYISSIKLLIG
LIAASSVFLLTLAALERGFSVKCSAKFEPKAFSSLKAIILLCAVLALTIATVPLLGGSEY
SASPLCLPLPFGEPSTTGYMVALVLLNSLCFLVMTVAYTKLYCNLEKGDLENIWDCSMVK
HIALLLFTNCILYCPVAFLSFSSLLNLTFIGPEVIKFILLVIGPLPACLNPLLYILFNPH
FKEDLGSLGKQAHFWTRSKHSSLMSINSDDVEKQSCDSTQALVTFTSASIAYDLPSNAGS
PSTYPMTESCHLSSVAFVPCL
Download sequence
Identical sequences S7NNU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]