SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S7PL37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S7PL37
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000389
Further Details:      
 
Domain Number 2 Region: 242-326,353-373
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 422-484
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000275
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S7PL37
Sequence length 496
Comment (tr|S7PL37|S7PL37_MYOBR) Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:EPQ08827.1} KW=Complete proteome; Reference proteome OX=109478 OS=Myotis brandtii (Brandt's bat). GN=D623_10002523 OC=Vespertilionidae; Myotis.
Sequence
MSGGPVGGRPGGRGTQAVQQNIPSTLLQDHENQRVFDMLGRKCWTLATAVIQLYMAMPPG
AERWAKKHCGAVCFVKDNPQKSYFIRLYSLQTGLLLWEQELYSQLVYSTPTSFFHTFAGD
DCQVGLNFADESEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPVNEERRGGFPPLPSH
PGGDQGGPAAGSLSLGMGTVDIQNPDITSSRYRGLPVPGPGPADKKRSGKKKIRKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPTVGSNKGRSGPLPPVPLGGVPPPPPPTPRG
PPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPMPPPPPPPPPPPPPSSGDLGPVGGLA
PVGGRGALLDQIRQGIQLNKTPGASESSALQPPPQSSEGLVGALMHVMQKRSKAIHSSDE
GEDQAGDDEEDDEWDD
Download sequence
Identical sequences S7PL37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]