SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S8DGY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S8DGY7
Domain Number - Region: 74-124
Classification Level Classification E-value
Superfamily HMG-box 0.00744
Family HMG-box 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S8DGY7
Sequence length 197
Comment (tr|S8DGY7|S8DGY7_FOMPI) Uncharacterized protein {ECO:0000313|EMBL:EPS92786.1} KW=Complete proteome; Reference proteome OX=743788 OS=Fomitopsis pinicola (strain FP-58527) (Brown rot fungus). GN=FOMPIDRAFT_1056553 OC=Agaricomycetes; Polyporales; Fomitopsis.
Sequence
MSQEVEVTAGPGPGPVRDAAAQLRADKQENIEADLQAWYSYSTTVAAKMSDDYALSQSHI
LNLMFQAGAKVIHSRNPNVYNAWLHRRADEVNDGLPKGERMKLSEIQEQYGEEYYELTDE
QKFELMEGLMDDRDTNFKGARLTSRGRLKTLSSVMQNIEKQYAYLKLVCGIDAMSLIVRN
DPSFHFDPISSGKTPFT
Download sequence
Identical sequences S8DGY7
jgi|Fompi3|1056553|gm1.12233_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]