SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S8ECA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S8ECA1
Domain Number 1 Region: 13-93
Classification Level Classification E-value
Superfamily HMG-box 4.58e-17
Family HMG-box 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S8ECA1
Sequence length 147
Comment (tr|S8ECA1|S8ECA1_FOMPI) Uncharacterized protein {ECO:0000313|EMBL:EPT02597.1} KW=Complete proteome; Reference proteome OX=743788 OS=Fomitopsis pinicola (strain FP-58527) (Brown rot fungus). GN=FOMPIDRAFT_140591 OC=Agaricomycetes; Polyporales; Fomitopsis.
Sequence
MTGPTRTDGAMRPGPTGSKPPRPPNAWILYRIDKLRELAERRDPTAPKRLQPEISKEISE
LWKAEDPEVKREYERIADIKKQEHQMQYPNYKFQPIKKEDRVRQREEEKAEKARVKEELR
KARGLQVPNLQNFSLASSSRRIAPYIP
Download sequence
Identical sequences S8ECA1
jgi|Fompi1|140591|estExt_Genewise1Plus.C_220306 jgi|Fompi3|140591|Fompi1.estExt_Genewise1Plus.C_220306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]