SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S8EH75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S8EH75
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily HMG-box 7.99e-17
Family HMG-box 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S8EH75
Sequence length 75
Comment (tr|S8EH75|S8EH75_FOMPI) Uncharacterized protein {ECO:0000313|EMBL:EPT02594.1} KW=Complete proteome; Reference proteome OX=743788 OS=Fomitopsis pinicola (strain FP-58527) (Brown rot fungus). GN=FOMPIDRAFT_1081834 OC=Agaricomycetes; Polyporales; Fomitopsis.
Sequence
PRPPNAWILYRSDKLRELAERRDPHAPKRLQADISKEISEMWKTEDPEIKREYERIADIK
KQEHRTQYPNYKFQP
Download sequence
Identical sequences S8EH75
jgi|Fompi3|1081834|gw1.13.25.1 jgi|Fompi1|8165|gw1.22.38.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]