SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S8FK05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  S8FK05
Domain Number - Region: 87-131
Classification Level Classification E-value
Superfamily HMG-box 0.000275
Family HMG-box 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S8FK05
Sequence length 147
Comment (tr|S8FK05|S8FK05_FOMPI) Uncharacterized protein {ECO:0000313|EMBL:EPT01746.1} KW=Complete proteome; Reference proteome OX=743788 OS=Fomitopsis pinicola (strain FP-58527) (Brown rot fungus). GN=FOMPIDRAFT_1048347 OC=Agaricomycetes; Polyporales; Fomitopsis.
Sequence
MVADADEREEIVQKALHELQTLPLRDLERFSTDTEKAMQVKKWFAKHSVEIRKARQGCKA
TTRGCDLWAREFKADILTTSHTVFVNEYPFDAYRKAMWKLWNALSEEKRKDWEKQGEAHR
AKVRGDLRGFVPPVLPQRSAALTLSSR
Download sequence
Identical sequences S8FK05
jgi|Fompi3|1048347|gm1.4027_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]