SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9VR66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9VR66
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.8e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.00035
Further Details:      
 
Domain Number 2 Region: 86-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9VR66
Sequence length 230
Comment (tr|S9VR66|S9VR66_SCHCR) Glutathione S-transferase Gst2 {ECO:0000313|EMBL:EPY50433.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_01190 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MYSSNILRKIAQFTLFSHKGSPNPWKVALTLKELNLSYEPVYYDFGKKEQKCKEHLAYNP
NGRVPTLVDHKNNDIAIWESDAILAYLTDRYDKERKISLPHDHPEYHHLLQYLFFQSSGQ
GVIWGQASWFNFYHPEPVTSAITRYRNETKRVLDRDYLVANKCTIADLSFVTWNDLLPAI
FGPGKNEFKEELPQLDFEKEFPKTHEWHKRLIERPAVSTALREREELLKQ
Download sequence
Identical sequences S9VR66
XP_013024916.1.62511 EPY50433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]