SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9VTK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9VTK3
Domain Number 1 Region: 116-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-41
Family Hypothetical protein AT3g04780/F7O18 27 0.00017
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.42e-29
Family Thioltransferase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S9VTK3
Sequence length 279
Comment (tr|S9VTK3|S9VTK3_SCHCR) Thioredoxin-like I protein Txl1 {ECO:0000313|EMBL:EPY49474.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_01360 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSVIEIRSHQHWISTIPKSGFLAVDCYADWCGPCKAISPVFSQLASKYSGPQFVFAKVNV
DDQTQIASSLGVRAMPTFIFFENGKQIDMLPGANAQALKEKVANIAGKLNGGSAGGSTST
NGYGNLRSCIENPQLECLNQSDEHHLRNALDLDSSSYLESDADEQLMIYIPFLEAVKIHS
LSITPVKENLSKAPKTIKLFINLPTVLSFEDADSFPATQIIEDIEYKSDDEPINIPLRFV
KFQRVNSLVIFVSSNVGDEETTQIGRFELFGESVGDSSK
Download sequence
Identical sequences S9VTK3
EPY49474 XP_013025502.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]