SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9VTQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9VTQ2
Domain Number 1 Region: 77-225
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.14e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S9VTQ2
Sequence length 229
Comment (tr|S9VTQ2|S9VTQ2_SCHCR) Glutathione S-transferase Gst2 {ECO:0000313|EMBL:EPY49544.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_01429 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MAQFTLFSHKGGPNPWKVVIALKELNLSYEPVFFDFEKNEQKNEQHLFYNPNGRVPTLID
HQNNDYAIWESDAILAYLADRYDKERKISLPHDHPEYHHLLQYLFFQSSGQGVIWGQAGW
FNLFHPEPVASAVIRYRNETKRVLGVLERILQNKDYLVADKYTIADVAFINWNSMLPSLF
GKGRHEFKEDLPQLDFEKEFPKTYAWHKRLTERPAVAATIAERQQALQQ
Download sequence
Identical sequences S9VTQ2
EPY49544 XP_013025571.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]