SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9VZR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9VZR9
Domain Number 1 Region: 36-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.44e-32
Family Thioltransferase 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S9VZR9
Sequence length 152
Comment (tr|S9VZR9|S9VZR9_SCHCR) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_03726 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MAATLFNQNKHLKTVNMFRNSFKLFGNQIRNLSTQTRQALEQAVKEDPVVLFMKGTPNQP
MCGFSLRSIQVLSLENVATDKLATYNVLSNEELRDGIKEFSDWPTIPQLYINGEFVGGCD
ILMSLHKSGELHKMLKEINALAPTKPEGDVAN
Download sequence
Identical sequences S9VZR9
XP_013021444.1.62511 EPY53188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]