SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9XD24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9XD24
Domain Number 1 Region: 19-247
Classification Level Classification E-value
Superfamily SET domain 1.96e-44
Family RuBisCo LSMT catalytic domain 0.0018
Further Details:      
 
Weak hits

Sequence:  S9XD24
Domain Number - Region: 239-293
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.00563
Family Inorganic pyrophosphatase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S9XD24
Sequence length 427
Comment (tr|S9XD24|S9XD24_SCHCR) Lysine methyltransferase Set8 {ECO:0000313|EMBL:EPY51736.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_00161 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MHPSSNELINAFVKKCIKLEIAEIEGKGRGLRCLEKCDSGQLLLEIPLVKVICEESITEY
RKKNKSFASIAESEEWDVMPSRKQVLFILCHLNGSNEKESEWNLYLSTLPSYIDTPVQWP
ESDIQGLQGTSLFMPVLAKQNFLREEWEELRTRYGNLWPGKITLSDWIHADALYNSRCLE
RPSGNTVLSPVIDLCNHSNSANSRWDFTSDAIQVYAQKTISVGDEITFNYGSSKGAGEFL
FSYGFIPQSIGDGTIDVVKILIPKDPNDPLDVVKRSCCKRPPMIEFASDPTGLWWHAPFL
YFSILNIQDFTFFHLEQNEYGDIEPQWEFEGQRTTIEELPKLILKSSLKDLYFLRVFCLV
EQLAEAALKHNLESDQYISSRKGVATNLLLRERNLFTKILPYLKGFIEDYAKSEVVSNYL
ATQDAEQ
Download sequence
Identical sequences S9XD24
EPY51736 XP_013023122.1.62511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]