SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9XET4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9XET4
Domain Number 1 Region: 84-190
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.29e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0081
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000764
Family Glutathione S-transferase (GST), N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S9XET4
Sequence length 229
Comment (tr|S9XET4|S9XET4_SCHCR) Glutathione S-transferase domain-containing protein {ECO:0000313|EMBL:EPY52286.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_01621 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MAFGTVYGSVKSPRVGMVLSTAALLGLPVENASNTLPGSFPKGLAEKFPIQKIPVFVGAD
GICLWQSIAIASFFASYDPLGIVGGATALAKAEVLMWACFFNQEFYDAVIPWVAGRMRSI
PYDPKTEEKAKKNTFSIFAVLERQVKDKEFLVGEDPTIADAAAVASLYFVLSSVMTKDEL
AKFPEIQRYYINAYPKLKFDQLCGPLQLLSEPVPIPKAPPSPILTCDEL
Download sequence
Identical sequences S9XET4
XP_013022178.1.62511 EPY52286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]