SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9XI87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9XI87
Domain Number 1 Region: 70-191
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000716
Family Glutathione S-transferase (GST), N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) S9XI87
Sequence length 226
Comment (tr|S9XI87|S9XI87_SCHCR) Glutathione S-transferase Gst3 {ECO:0000313|EMBL:EPY53366.1} KW=Complete proteome; Reference proteome OX=653667 OS=11777 / NBRC 106824 / NRRL Y48691) (Fission yeast). GN=SPOG_03893 OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MIILHHLADSRSSRIIWLLEEMKVPYKLKHYDRKSPALEDNGKTYIESAAVIEHLVRKYK
RDLKPSEDNLDALEKYEFWMHYAEGSLMMLVVGLFVNNKAVDMSPLVSRFLVRKVTNTIN
ENYYLKELFLNLEHVDDFLSTSKFVTGDHFTAADVQMSYPLLCLQSTVLKSRPYTNIKRW
LIEVTSRPAFEVASHKAHDKVFQLLNETTQGKDEEIADFSSFSISA
Download sequence
Identical sequences S9XI87
XP_013021611.1.62511 EPY53366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]