SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9Y219 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9Y219
Domain Number 1 Region: 29-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-18
Family Glutathione peroxidase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) S9Y219
Sequence length 161
Comment (tr|S9Y219|S9Y219_MANHA) Uncharacterized protein {ECO:0000313|EMBL:EPY98829.1} KW=Complete proteome OX=1329905 OS=Mannheimia haemolytica D35. GN=L278_12255 OC=Pasteurellaceae; Mannheimia.
Sequence
MMKKIISLLIMMLSLNSYAQENSHLGHIPLKDLNQNQITLDKYQGKKIYIKAWASWCSIC
LAGLAEIEEISQKANNDIEIITIVSPGHKGEKTTNQFIEWYKGIESDYPNITVLLDEQGD
FIKQTEIRGYPHNLLLDSSLNLKKSIPGHLNSEQILHSITN
Download sequence
Identical sequences S9Y219
gi|525656962|ref|YP_008220386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]