SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for S9YEG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  S9YEG8
Domain Number 1 Region: 37-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.22e-24
Family Glutathione peroxidase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) S9YEG8
Sequence length 177
Comment (tr|S9YEG8|S9YEG8_MANHA) Dihydroneopterin aldolase {ECO:0000313|EMBL:EPZ00521.1} KW=Complete proteome OX=1329905 OS=Mannheimia haemolytica D35. GN=L278_00635 OC=Pasteurellaceae; Mannheimia.
Sequence
MKKILLLIPLLLLVVIVGFLTVPLMNKDALAPTEDWQGKPFPEFVGKNLLDSNAHLNNNS
LPKEPYILNVWASWCTWCIKEFPILLELKQKGVPIVGLTYSDRPNDALNALKNWGNPFSL
IIDDYEKGFLIQTLKVSSAPSSYLIDKHGVVRYQQKGYNPDFAQDFLPKLEALRNEK
Download sequence
Identical sequences A0A0B5BY86 E2PBE0 S9YEG8
WP_006251785.1.20456 WP_006251785.1.2132 WP_006251785.1.23336 WP_006251785.1.26880 WP_006251785.1.27302 WP_006251785.1.28573 WP_006251785.1.30596 WP_006251785.1.39283 WP_006251785.1.41844 WP_006251785.1.44810 WP_006251785.1.49314 WP_006251785.1.49495 WP_006251785.1.63192 WP_006251785.1.72771 WP_006251785.1.8479 WP_006251785.1.9701 gi|472335804|ref|YP_007668078.1| gi|525657474|ref|YP_008220911.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]